EIF2D anticorps (Middle Region)
-
- Antigène Voir toutes EIF2D Anticorps
- EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF2D est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Ligatin antibody was raised against the middle region of LGTN
- Purification
- Affinity purified
- Immunogène
- Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ
- Top Product
- Discover our top product EIF2D Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Ligatin Blocking Peptide, catalog no. 33R-4725, is also available for use as a blocking control in assays to test for specificity of this Ligatin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGTN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))
- Autre désignation
- Ligatin (EIF2D Produits)
- Synonymes
- anticorps LGTN, anticorps HCA56, anticorps D1Ertd5e, anticorps Lgtn, anticorps eukaryotic translation initiation factor 2D, anticorps EIF2D, anticorps Eif2d
- Sujet
- LGTN is a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively.
- Poids moléculaire
- 65 kDa (MW of target protein)
-