RBPMS2 anticorps (Middle Region)

N° du produit ABIN633407

Détail du produit anti-RBPMS2 anticorps

Antigène: RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBPMS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBPMS2 antibody was raised against the middle region of RBPMS2

Purification: Affinity purified

Immunogène: RBPMS2 antibody was raised using the middle region of RBPMS2 corresponding to a region with amino acids MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBPMS2 Blocking Peptide, catalog no. 33R-6010, is also available for use as a blocking control in assays to test for specificity of this RBPMS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBPMS2

Antigène: RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))

Autre désignation: RBPMS2 (RBPMS2 Produits)

Synonymes: anticorps hermes, anticorps RBPMS, anticorps 2400008B06Rik, anticorps AI316523, anticorps RGD1561222, anticorps rbpms2, anticorps zgc:55559, anticorps zgc:77170, anticorps RNA binding protein with multiple splicing 2 L homeolog, anticorps RNA binding protein with multiple splicing 2, anticorps RNA binding protein with multiple splicing 2b, anticorps rbpms2.L, anticorps RBPMS2, anticorps Rbpms2, anticorps rbpms2b

Sujet: The function of RBPMS2 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 22 kDa (MW of target protein)