PABPC5 anticorps

N° du produit ABIN633413

Détail du produit anti-PABPC5 anticorps

Antigène: PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PABPC5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PABPC5 Blocking Peptide, catalog no. 33R-1849, is also available for use as a blocking control in assays to test for specificity of this PABPC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PABPC5

Antigène: PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))

Autre désignation: PABPC5 (PABPC5 Produits)

Sujet: PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.

Poids moléculaire: 43 kDa (MW of target protein)