PABPC5 anticorps
-
- Antigène Voir toutes PABPC5 Anticorps
- PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PABPC5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
- Top Product
- Discover our top product PABPC5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PABPC5 Blocking Peptide, catalog no. 33R-1849, is also available for use as a blocking control in assays to test for specificity of this PABPC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))
- Autre désignation
- PABPC5 (PABPC5 Produits)
- Sujet
- PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.
- Poids moléculaire
- 43 kDa (MW of target protein)
-