SR140 anticorps (N-Term)

N° du produit ABIN633416

Détail du produit anti-SR140 anticorps

Antigène: SR140 (U2-Associated SR140 Protein (SR140))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SR140 est non-conjugé

Application: Western Blotting (WB)

Specificité: SR140 antibody was raised against the N terminal of SR140

Purification: Affinity purified

Immunogène: SR140 antibody was raised using the N terminal of SR140 corresponding to a region with amino acids NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SR140 Blocking Peptide, catalog no. 33R-6779, is also available for use as a blocking control in assays to test for specificity of this SR140 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SR140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SR140

Antigène: SR140 (U2-Associated SR140 Protein (SR140))

Autre désignation: SR140 (SR140 Produits)

Synonymes: anticorps SR140, anticorps fSAPa, anticorps 2610101N10Rik, anticorps AU023006, anticorps Sr140, anticorps U2-associated SR140 protein, anticorps U2 snRNP associated SURP domain containing, anticorps U2 snRNP-associated SURP domain containing, anticorps CpipJ_CPIJ014539, anticorps U2SURP, anticorps U2surp

Sujet: The specific function of SR140 is not yet known.

Poids moléculaire: 118 kDa (MW of target protein)