DAZ3 anticorps (Middle Region)
-
- Antigène Voir toutes DAZ3 Anticorps
- DAZ3 (Deleted In Azoospermia 3 (DAZ3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DAZ3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DAZ3 antibody was raised against the middle region of DAZ3
- Purification
- Affinity purified
- Immunogène
- DAZ3 antibody was raised using the middle region of DAZ3 corresponding to a region with amino acids PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF
- Top Product
- Discover our top product DAZ3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DAZ3 Blocking Peptide, catalog no. 33R-7082, is also available for use as a blocking control in assays to test for specificity of this DAZ3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DAZ3 (Deleted In Azoospermia 3 (DAZ3))
- Autre désignation
- DAZ3 (DAZ3 Produits)
- Synonymes
- anticorps pDP1679, anticorps DAZ3, anticorps DAZ2, anticorps deleted in azoospermia 3, anticorps deleted in azoospermia protein 3, anticorps DAZ3, anticorps LOC738636
- Sujet
- This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia.
- Poids moléculaire
- 49 kDa (MW of target protein)
-