SRP54 anticorps (Middle Region)

N° du produit ABIN633422

Détail du produit anti-SRP54 anticorps

Antigène: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRP54 est non-conjugé

Application: Western Blotting (WB)

Specificité: SRP54 antibody was raised against the middle region of SRP54

Purification: Affinity purified

Immunogène: SRP54 antibody was raised using the middle region of SRP54 corresponding to a region with amino acids ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRP54 Blocking Peptide, catalog no. 33R-2603, is also available for use as a blocking control in assays to test for specificity of this SRP54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRP54

Antigène: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Autre désignation: SRP54 (SRP54 Produits)

Synonymes: anticorps Srp54k, anticorps zgc:55842, anticorps zgc:85713, anticorps SRP54, anticorps signal recognition particle 54, anticorps signal recognition particle protein, anticorps signal recognition particle subunit Srp54, anticorps signal recognition particle, anticorps family with sequence similarity 177 member A1, anticorps signal recognition particle 54kDa S homeolog, anticorps signal recognition particle 54kDa, anticorps SRP54, anticorps srp54, anticorps SSO_RS04840, anticorps MA_RS23935, anticorps AF_RS03170, anticorps PAB_RS02540, anticorps MSP_RS07670, anticorps RCI_RS04175, anticorps TGAM_RS09885, anticorps MTBMA_RS08340, anticorps FAM177A1, anticorps srp54.S, anticorps Srp54

Sujet: SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome