KLHDC8A anticorps (Middle Region)
-
- Antigène Voir toutes KLHDC8A Anticorps
- KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLHDC8A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KLHDC8 A antibody was raised against the middle region of KLHDC8
- Purification
- Affinity purified
- Immunogène
- KLHDC8 A antibody was raised using the middle region of KLHDC8 corresponding to a region with amino acids NQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQG
- Top Product
- Discover our top product KLHDC8A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLHDC8A Blocking Peptide, catalog no. 33R-6843, is also available for use as a blocking control in assays to test for specificity of this KLHDC8A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))
- Autre désignation
- KLHDC8A (KLHDC8A Produits)
- Synonymes
- anticorps KLHDC8A, anticorps KLHL18, anticorps MGC145950, anticorps A630065K24Rik, anticorps RGD1305132, anticorps kelch domain containing 8A, anticorps kelch domain containing 8A S homeolog, anticorps KLHDC8A, anticorps klhdc8a, anticorps Klhdc8a, anticorps klhdc8a.S
- Sujet
- The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 39 kDa (MW of target protein)
-