GIPC1 anticorps (N-Term)

N° du produit ABIN633430

Détail du produit anti-GIPC1 anticorps

Antigène: GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GIPC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GIPC1 antibody was raised against the N terminal of GIPC1

Purification: Affinity purified

Immunogène: GIPC1 antibody was raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GIPC1 Blocking Peptide, catalog no. 33R-8461, is also available for use as a blocking control in assays to test for specificity of this GIPC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GIPC1

Antigène: GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))

Autre désignation: GIPC1 (GIPC1 Produits)

Synonymes: anticorps C19orf3, anticorps GIPC, anticorps GLUT1CBP, anticorps Hs.6454, anticorps IIP-1, anticorps NIP, anticorps RGS19IP1, anticorps SEMCAP, anticorps SYNECTIIN, anticorps SYNECTIN, anticorps TIP-2, anticorps XGIPC, anticorps kermit, anticorps rgs19ip1, anticorps gipc3, anticorps iip-1, anticorps Kermit, anticorps semcap, anticorps glut1cbp, anticorps synectiin, anticorps GIPC1, anticorps Glut1CIP, anticorps Rgs19ip1, anticorps Semcap1, anticorps TaxIP2, anticorps Gipc, anticorps Rgs19, anticorps GIPC PDZ domain containing family member 1, anticorps GIPC PDZ domain containing family member 1 L homeolog, anticorps GIPC PDZ domain containing family, member 1, anticorps RGS-GAIP interacting protein GIPC, anticorps PDZ domain-containing protein GIPC3, anticorps putative rgs-gaip interacting protein gipc, anticorps GIPC1, anticorps gipc1.L, anticorps gipc1, anticorps Gipc1, anticorps LOC692815, anticorps LOC5576629, anticorps Smp_170870

Sujet: GIPC1 belongs to the GIPC family. It may be involved in G protein-linked signaling.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport