CPSF1 anticorps (Middle Region)
-
- Antigène Voir toutes CPSF1 Anticorps
- CPSF1 (Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPSF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CPSF1 antibody was raised against the middle region of CPSF1
- Purification
- Affinity purified
- Immunogène
- CPSF1 antibody was raised using the middle region of CPSF1 corresponding to a region with amino acids GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE
- Top Product
- Discover our top product CPSF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CPSF1 Blocking Peptide, catalog no. 33R-3195, is also available for use as a blocking control in assays to test for specificity of this CPSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPSF1 (Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1))
- Autre désignation
- CPSF1 (CPSF1 Produits)
- Synonymes
- anticorps CG10110, anticorps CPSF, anticorps CPSF-160, anticorps CPSF160, anticorps Cpsf, anticorps Dmel\\CG10110, anticorps anon-WO0118547.217, anticorps cpsf, anticorps dCPSF-160, anticorps wu:fb24c01, anticorps CPSF1, anticorps DKFZp469K0832, anticorps HSU37012, anticorps P/cl.18, anticorps ATCPSF160, anticorps K17N15.21, anticorps K17N15_21, anticorps cleavage and polyadenylation specificity factor 160, anticorps cleavage and polyadenylation specific factor 1, anticorps Cleavage and polyadenylation specificity factor 160, anticorps cleavage and polyadenylation specific factor 1 L homeolog, anticorps cleavage and polyadenylation specificity factor subunit 1, anticorps cleavage and polyadenylation specificity factor 160, anticorps Cpsf1, anticorps Cpsf160, anticorps cpsf1.L, anticorps cpsf1, anticorps CPSF1, anticorps Tsp_05366, anticorps CPSF160
- Sujet
- CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.
- Poids moléculaire
- 161 kDa (MW of target protein)
-