CPSF2 anticorps (N-Term)

N° du produit ABIN633438

Détail du produit anti-CPSF2 anticorps

Antigène: CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPSF2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CPSF2 antibody was raised against the N terminal of CPSF2

Purification: Affinity purified

Immunogène: CPSF2 antibody was raised using the N terminal of CPSF2 corresponding to a region with amino acids YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPSF2 Blocking Peptide, catalog no. 33R-10053, is also available for use as a blocking control in assays to test for specificity of this CPSF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPSF2

Antigène: CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))

Autre désignation: CPSF2 (CPSF2 Produits)

Synonymes: anticorps CPSF100, anticorps 100kDa, anticorps 2610024B04Rik, anticorps AI662483, anticorps Cpsf, anticorps MCPSF, anticorps mKIAA1367, anticorps zgc:92484, anticorps cpsf2-A, anticorps cleavage and polyadenylation specific factor 2, anticorps cleavage and polyadenylation specific factor 2 S homeolog, anticorps cleavage and polyadenylation specificity factor subunit 2, anticorps CPSF2, anticorps Cpsf2, anticorps cpsf2, anticorps PAAG_07931, anticorps cpsf2.S, anticorps LOC582050, anticorps LOC100157277, anticorps LOC100179344

Sujet: CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.

Poids moléculaire: 88 kDa (MW of target protein)