Filensin anticorps (N-Term)

N° du produit ABIN633449

Détail du produit anti-Filensin anticorps

Antigène: Filensin (BFSP1) (Beaded Filament Structural Protein 1, Filensin (BFSP1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Filensin est non-conjugé

Application: Western Blotting (WB)

Specificité: BFSP1 antibody was raised against the N terminal of BFSP1

Purification: Affinity purified

Immunogène: BFSP1 antibody was raised using the N terminal of BFSP1 corresponding to a region with amino acids QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BFSP1 Blocking Peptide, catalog no. 33R-7771, is also available for use as a blocking control in assays to test for specificity of this BFSP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BFSP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-Filensin (ABIN633449)

Brennan, McGreal-Estrada, Logan, Cvekl, Menko, Kantorow: "BNIP3L/NIX is required for elimination of mitochondria, endoplasmic reticulum and Golgi apparatus during eye lens organelle-free zone formation." dans: Experimental eye research, Vol. 174, pp. 173-184, (2019) (PubMed).

Détails sur Filensin

Antigène: Filensin (BFSP1) (Beaded Filament Structural Protein 1, Filensin (BFSP1))

Autre désignation: BFSP1 (BFSP1 Produits)

Synonymes: anticorps BFSP1, anticorps CP115, anticorps CP94, anticorps CTRCT33, anticorps LIFL-H, anticorps Bfsp1, anticorps 115-kDa, anticorps CP95, anticorps CP97, anticorps MGC84254, anticorps LOC100220461, anticorps beaded filament structural protein 1, anticorps beaded filament structural protein 1 L homeolog, anticorps beaded filament structural protein 1, in lens-CP94, anticorps BFSP1, anticorps Bfsp1, anticorps bfsp1.L

Sujet: More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and BFSP1 (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament.

Poids moléculaire: 74 kDa (MW of target protein)