Synaptojanin 1 anticorps (N-Term)
-
- Antigène Voir toutes Synaptojanin 1 (SYNJ1) Anticorps
- Synaptojanin 1 (SYNJ1)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Synaptojanin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Synaptojanin 1 antibody was raised against the N terminal of SYNJ1
- Purification
- Affinity purified
- Immunogène
- Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR
- Top Product
- Discover our top product SYNJ1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Synaptojanin 1 Blocking Peptide, catalog no. 33R-3930, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Synaptojanin 1 (SYNJ1)
- Autre désignation
- Synaptojanin 1 (SYNJ1 Produits)
- Synonymes
- anticorps CG6562, anticorps Dmel\\CG6562, anticorps IPP, anticorps Synj, anticorps fb02f11, anticorps fi15a11, anticorps nrc, anticorps wu:fb02f11, anticorps wu:fi15a11, anticorps SYNJ1, anticorps INPP5G, anticorps A930006D20Rik, anticorps AA675315, anticorps mKIAA0910, anticorps Synaptojanin, anticorps synaptojanin 1, anticorps Synj, anticorps synj1, anticorps SYNJ1, anticorps Synj1
- Sujet
- Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.
- Poids moléculaire
- 143 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process, Synaptic Vesicle Exocytosis
-