TNRC6B anticorps (N-Term)

N° du produit ABIN633454

Détail du produit anti-TNRC6B anticorps

Antigène: TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNRC6B est non-conjugé

Application: Western Blotting (WB)

Specificité: TNRC6 B antibody was raised against the N terminal of TNRC6

Purification: Affinity purified

Immunogène: TNRC6 B antibody was raised using the N terminal of TNRC6 corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TNRC6B Blocking Peptide, catalog no. 33R-5339, is also available for use as a blocking control in assays to test for specificity of this TNRC6B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNRC6B

Antigène: TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))

Autre désignation: TNRC6B (TNRC6B Produits)

Synonymes: anticorps hm:zeh0114, anticorps im:6968518, anticorps wu:fa01f05, anticorps 2700090M07Rik, anticorps A730065C02Rik, anticorps AI848765, anticorps D230019K20Rik, anticorps Cbl27, anticorps trinucleotide repeat containing 6b, anticorps trinucleotide repeat containing 6B, anticorps trinucleotide repeat containing 6B S homeolog, anticorps tnrc6b, anticorps TNRC6B, anticorps tnrc6b.S, anticorps Tnrc6b

Sujet: TNRC6B is involved in the binding of RNA and nucleotides.

Poids moléculaire: 109 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway