SFRS8 anticorps

N° du produit ABIN633458

Détail du produit anti-SFRS8 anticorps

Antigène: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS8 Blocking Peptide, catalog no. 33R-5508, is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS8

Antigène: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Autre désignation: SFRS8 (SFSWAP Produits)

Synonymes: anticorps SFRS8, anticorps SWAP, anticorps 1190005N23Rik, anticorps 6330437E22Rik, anticorps AI197402, anticorps AW212079, anticorps Sfrs8, anticorps Srsf8, anticorps splicing factor SWAP, anticorps splicing factor, suppressor of white-apricot homolog (Drosophila), anticorps splicing factor SWAP homolog, anticorps SFSWAP, anticorps Sfswap

Sujet: This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified although their full-length natures have not been characterized to date.

Poids moléculaire: 105 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization