FAM156A anticorps (N-Term)
-
- Antigène Tous les produits FAM156A
- FAM156A (Family with Sequence Similarity 156, Member A (FAM156A))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM156A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM156 A antibody was raised against the N terminal of FAM156
- Purification
- Affinity purified
- Immunogène
- FAM156 A antibody was raised using the N terminal of FAM156 corresponding to a region with amino acids DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM156A Blocking Peptide, catalog no. 33R-2106, is also available for use as a blocking control in assays to test for specificity of this FAM156A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM150 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM156A (Family with Sequence Similarity 156, Member A (FAM156A))
- Autre désignation
- FAM156A (FAM156A Produits)
- Synonymes
- anticorps PRO0659, anticorps TMEM29, anticorps family with sequence similarity 156 member A, anticorps FAM156A
- Sujet
- The function of FAM156A protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 24 kDa (MW of target protein)
-