EXOSC6 anticorps (N-Term)

N° du produit ABIN633462

Détail du produit anti-EXOSC6 anticorps

Antigène: EXOSC6 (Exosome Component 6 (EXOSC6))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOSC6 est non-conjugé

Application: Western Blotting (WB)

Specificité: EXOSC6 antibody was raised against the N terminal of EXOSC6

Purification: Affinity purified

Immunogène: EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOSC6 Blocking Peptide, catalog no. 33R-5560, is also available for use as a blocking control in assays to test for specificity of this EXOSC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOSC6

Antigène: EXOSC6 (Exosome Component 6 (EXOSC6))

Autre désignation: EXOSC6 (EXOSC6 Produits)

Synonymes: anticorps exosc6, anticorps RAR-gamma, anticorps id:ibd1130, anticorps wu:fe17d05, anticorps zgc:110071, anticorps EAP4, anticorps MTR3, anticorps Mtr3p, anticorps hMtr3p, anticorps p11, anticorps 2610510N21Rik, anticorps C76919, anticorps Mtr3, anticorps exosome component 6, anticorps EXOSC6, anticorps exosc6, anticorps CpipJ_CPIJ018071, anticorps Exosc6

Sujet: EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response