SSB anticorps

N° du produit ABIN633464

Détail du produit anti-SSB anticorps

Antigène: SSB (Sjogren Syndrome Antigen B (SSB))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SSB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SSB Blocking Peptide, catalog no. 33R-4149, is also available for use as a blocking control in assays to test for specificity of this SSB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SSB

Antigène: SSB (Sjogren Syndrome Antigen B (SSB))

Autre désignation: SSB (SSB Produits)

Synonymes: anticorps LARP3, anticorps La, anticorps lab1, anticorps larp3, anticorps ssb, anticorps Mt-SSB, anticorps MtSSB, anticorps Ssbp1, anticorps SS-B, anticorps laa-a, anticorps ssb-a, anticorps ssb-b, anticorps wu:fb17f11, anticorps zgc:55588, anticorps Sjogren syndrome antigen B, anticorps Sjogren syndrome antigen B L homeolog, anticorps single stranded DNA binding protein 1, anticorps Sjogren syndrome antigen B S homeolog, anticorps Sjogren syndrome antigen B (autoantigen La), anticorps SSB, anticorps ssb.L, anticorps SSBP1, anticorps Ssb, anticorps ssb.S, anticorps ssb

Sujet: SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.

Poids moléculaire: 45 kDa (MW of target protein)