DAZ4 anticorps (N-Term)

N° du produit ABIN633468

Détail du produit anti-DAZ4 anticorps

Antigène: DAZ4 (Deleted In Azoospermia 4 (DAZ4))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAZ4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: DAZ4 antibody was raised against the N terminal of DAZ4

Purification: Affinity purified

Immunogène: DAZ4 antibody was raised using the N terminal of DAZ4 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAZ4 Blocking Peptide, catalog no. 33R-6390, is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAZ4

Antigène: DAZ4 (Deleted In Azoospermia 4 (DAZ4))

Autre désignation: DAZ4 (DAZ4 Produits)

Synonymes: anticorps pDP1680, anticorps pDP1681, anticorps DAZ4, anticorps deleted in azoospermia 4, anticorps DAZ4

Sujet: This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

Poids moléculaire: 36 kDa (MW of target protein)