ADAD2 anticorps (C-Term)

N° du produit ABIN633494

Détail du produit anti-ADAD2 anticorps

Antigène: ADAD2 (Adenosine Deaminase Domain Containing 2 (ADAD2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ADAD2 antibody was raised against the C terminal of ADAD2

Purification: Affinity purified

Immunogène: ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAD2 Blocking Peptide, catalog no. 33R-9218, is also available for use as a blocking control in assays to test for specificity of this ADAD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAD2

Antigène: ADAD2 (Adenosine Deaminase Domain Containing 2 (ADAD2))

Autre désignation: ADAD2 (ADAD2 Produits)

Synonymes: anticorps tenrl, anticorps MGC145701, anticorps TENRL, anticorps 4930403J07Rik, anticorps RGD1560949, anticorps adenosine deaminase domain containing 2, anticorps adenosine deaminase domain containing 2 S homeolog, anticorps ADAD2, anticorps adad2, anticorps adad2.S, anticorps Adad2

Sujet: ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.

Poids moléculaire: 71 kDa (MW of target protein)