ADAD2 anticorps (C-Term)
-
- Antigène Tous les produits ADAD2
- ADAD2 (Adenosine Deaminase Domain Containing 2 (ADAD2))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADAD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ADAD2 antibody was raised against the C terminal of ADAD2
- Purification
- Affinity purified
- Immunogène
- ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADAD2 Blocking Peptide, catalog no. 33R-9218, is also available for use as a blocking control in assays to test for specificity of this ADAD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADAD2 (Adenosine Deaminase Domain Containing 2 (ADAD2))
- Autre désignation
- ADAD2 (ADAD2 Produits)
- Sujet
- ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.
- Poids moléculaire
- 71 kDa (MW of target protein)
-