CDC5L anticorps

N° du produit ABIN633497

Détail du produit anti-CDC5L anticorps

Antigène: CDC5L (CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDC5L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CDC5 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDC5L Blocking Peptide, catalog no. 33R-5034, is also available for use as a blocking control in assays to test for specificity of this CDC5L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDC5L

Antigène: CDC5L (CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L))

Autre désignation: CDC5L (CDC5L Produits)

Synonymes: anticorps zgc:55853, anticorps CDC5L, anticorps CDC5, anticorps CDC5-LIKE, anticorps CEF1, anticorps PCDC5RP, anticorps dJ319D22.1, anticorps 1200002I02Rik, anticorps AA408004, anticorps ARABIDOPSIS THALIANA CELL DIVISION CYCLE 5, anticorps ARABIDOPSIS THALIANA MYB DOMAIN CELL DIVISION CYCLE 5, anticorps ATCDC5, anticorps ATMYBCDC5, anticorps F21M12.15, anticorps F21M12_15, anticorps cell division cycle 5, anticorps CDC5 cell division cycle 5-like (S. pombe), anticorps cell division cycle 5 like, anticorps cell division cycle 5-like, anticorps cell division cycle 5 like S homeolog, anticorps cell division cycle 5-like (S. pombe), anticorps cell division cycle 5, anticorps cdc5l, anticorps CDC5L, anticorps Chro.50385, anticorps Cdc5l, anticorps cdc5l.S, anticorps CDC5

Sujet: CDC5L shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. CDC5L has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Chromatin Binding