APOBEC3F anticorps (C-Term)

N° du produit ABIN633498

Détail du produit anti-APOBEC3F anticorps

Antigène: APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOBEC3F est non-conjugé

Application: Western Blotting (WB)

Specificité: ApoBEC3 F antibody was raised against the C terminal of APOBEC3

Purification: Affinity purified

Immunogène: ApoBEC3 F antibody was raised using the C terminal of APOBEC3 corresponding to a region with amino acids ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ApoBEC3F Blocking Peptide, catalog no. 33R-1538, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3F antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOBEC3F

Antigène: APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))

Autre désignation: ApoBEC3F (APOBEC3F Produits)

Synonymes: anticorps A3F, anticorps ARP8, anticorps BK150C2.4.MRNA, anticorps KA6, anticorps APOBEC3F, anticorps apolipoprotein B mRNA editing enzyme catalytic subunit 3F, anticorps apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F, anticorps APOBEC3F

Sujet: APOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 45 kDa (MW of target protein)