RPLP0 anticorps (N-Term)

N° du produit ABIN633509

Détail du produit anti-RPLP0 anticorps

Antigène: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPLP0 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPLP0 antibody was raised against the N terminal of RPLP0

Purification: Affinity purified

Immunogène: RPLP0 antibody was raised using the N terminal of RPLP0 corresponding to a region with amino acids TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPLP0 Blocking Peptide, catalog no. 33R-9044, is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPLP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPLP0

Antigène: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Autre désignation: RPLP0 (RPLP0 Produits)

Synonymes: anticorps AP3, anticorps Ap3, anticorps Ape, anticorps CG7490, anticorps Dmel\\CG7490, anticorps LP0, anticorps P0, anticorps P35, anticorps PO, anticorps RLA0, anticorps RPL P0, anticorps RpP0, anticorps RpPO, anticorps Rplp0, anticorps l(3)0154, anticorps l(3)01544, anticorps p0, anticorps RPLP0, anticorps arp, anticorps fa56b12, anticorps fb04a12, anticorps wu:fa56b12, anticorps wu:fb15a08, anticorps wu:fk48c12, anticorps arbp, anticorps l10e, anticorps lp0, anticorps prlp0, anticorps rpp0, anticorps L10E, anticorps PRLP0, anticorps RPP0, anticorps 36B4, anticorps Arbp, anticorps ARBP, anticorps Ribosomal protein LP0, anticorps ribosomal protein lateral stalk subunit P0, anticorps ribosomal protein, large, P0, anticorps ribosomal protein, large, P0 S homeolog, anticorps RpLP0, anticorps RPLP0, anticorps rplp0, anticorps rplp0.S, anticorps Rplp0

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins.

Poids moléculaire: 34 kDa (MW of target protein)