Synaptojanin 2 anticorps (N-Term)
-
- Antigène Voir toutes Synaptojanin 2 (SYNJ2) Anticorps
- Synaptojanin 2 (SYNJ2)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Synaptojanin 2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Synaptojanin 2 antibody was raised against the N terminal of SYNJ2
- Purification
- Affinity purified
- Immunogène
- Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL
- Top Product
- Discover our top product SYNJ2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Synaptojanin 2 Blocking Peptide, catalog no. 33R-8466, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Synaptojanin 2 (SYNJ2)
- Autre désignation
- Synaptojanin 2 (SYNJ2 Produits)
- Synonymes
- anticorps SYNJ2, anticorps INPP5H, anticorps AI481647, anticorps SJ2, anticorps mKIAA0348, anticorps synaptojanin 2, anticorps synaptojanin-2, anticorps SYNJ2, anticorps LOC100074269, anticorps synj2, anticorps Synj2
- Sujet
- SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function.
- Poids moléculaire
- 165 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-