NSF anticorps (C-Term)

N° du produit ABIN633516

Détail du produit anti-NSF anticorps

Antigène: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSF est non-conjugé

Application: Western Blotting (WB)

Specificité: NSF antibody was raised against the C terminal of NSF

Purification: Affinity purified

Immunogène: NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSF Blocking Peptide, catalog no. 33R-8893, is also available for use as a blocking control in assays to test for specificity of this NSF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSF

Antigène: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Autre désignation: NSF (NSF Produits)

Synonymes: anticorps SKD2, anticorps AI316878, anticorps AU020090, anticorps AU067812, anticorps NSF, anticorps 18.m06598, anticorps nsf, anticorps si:bz18k17.1, anticorps wu:fj33g11, anticorps N-ethylmaleimide sensitive factor, anticorps T1J1.4, anticorps T1J1_4, anticorps NEM-sensitive fusion protein, anticorps N-ethylmaleimide sensitive factor, vesicle fusing ATPase, anticorps N-ethylmaleimide sensitive fusion protein, anticorps N-ethylmaleimide-sensitive factor, anticorps N-ethylmaleimide sensitive factor, anticorps N-ethylmaleimide-sensitive fusion protein, putative, anticorps N-ethylmaleimide sensitive factor L homeolog, anticorps vesicle-fusing ATPase, anticorps N-ethylmaleimide-sensitive factor a, anticorps AAA-type ATPase family protein, anticorps NSF, anticorps Nsf, anticorps nsf, anticorps BBOV_II007200, anticorps TGME49_318510, anticorps nsf.L, anticorps LOC100180685, anticorps LOC9310886, anticorps nsfa

Sujet: NSF is required for vesicle-mediated transport. NSF catalyzes the fusion of transport vesicles within the Golgi cisternae. It is s also required for transport from the endoplasmic reticulum to the Golgi stack. NSF seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.

Poids moléculaire: 33 kDa (MW of target protein)