CNOT6 anticorps (N-Term)

N° du produit ABIN633523

Détail du produit anti-CNOT6 anticorps

Antigène: CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNOT6 est non-conjugé

Application: Western Blotting (WB)

Specificité: CNOT6 antibody was raised against the N terminal of CNOT6

Purification: Affinity purified

Immunogène: CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNOT6 Blocking Peptide, catalog no. 33R-2486, is also available for use as a blocking control in assays to test for specificity of this CNOT6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNOT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNOT6

Antigène: CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))

Autre désignation: CNOT6 (CNOT6 Produits)

Synonymes: anticorps CCR4, anticorps A230103N10Rik, anticorps AA407540, anticorps AW456442, anticorps RGD1310783, anticorps wu:fa03c11, anticorps wu:fc17f01, anticorps zgc:65822, anticorps CCR4-NOT transcription complex subunit 6, anticorps CCR4-NOT transcription complex, subunit 6, anticorps CCR4-NOT transcription complex, subunit 6a, anticorps CNOT6, anticorps Cnot6, anticorps cnot6a, anticorps cnot6

Sujet: CNOT6 is a subunit of the CCR4-NOT core transcriptional regulation complex. CNOT6 has a 3'-5' RNase activity and prefers polyadenylated substates.

Poids moléculaire: 63 kDa (MW of target protein)