C19orf24 anticorps (N-Term)

N° du produit ABIN633528

Détail du produit anti-C19orf24 anticorps

Antigène: C19orf24 (Chromosome 19 Open Reading Frame 24 (C19orf24))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf24 est non-conjugé

Application: Western Blotting (WB)

Specificité: C19 ORF24 antibody was raised against the N terminal Of C19 rf24

Purification: Affinity purified

Immunogène: C19 ORF24 antibody was raised using the N terminal Of C19 rf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF24 Blocking Peptide, catalog no. 33R-6357, is also available for use as a blocking control in assays to test for specificity of this C19ORF24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf24

Antigène: C19orf24 (Chromosome 19 Open Reading Frame 24 (C19orf24))

Autre désignation: C19ORF24 (C19orf24 Produits)

Synonymes: anticorps chromosome 19 open reading frame 24, anticorps C19orf24, anticorps c19orf24

Sujet: C19orf24 is a novel human non-classical secreted protein which is encoded by the hypothetical gene C19orf24 (chromosome 19 open reading frame 24). The exact function of C19orf24 remains unknown.

Poids moléculaire: 14 kDa (MW of target protein)