SRBD1 anticorps (N-Term)
-
- Antigène Tous les produits SRBD1
- SRBD1 (S1 RNA Binding Domain 1 (SRBD1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRBD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SRBD1 antibody was raised against the N terminal of SRBD1
- Purification
- Affinity purified
- Immunogène
- SRBD1 antibody was raised using the N terminal of SRBD1 corresponding to a region with amino acids MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SRBD1 Blocking Peptide, catalog no. 33R-6501, is also available for use as a blocking control in assays to test for specificity of this SRBD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRBD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRBD1 (S1 RNA Binding Domain 1 (SRBD1))
- Autre désignation
- SRBD1 (SRBD1 Produits)
- Synonymes
- anticorps AI461933, anticorps C85414, anticorps D530025C17Rik, anticorps S1 RNA binding domain 1, anticorps SRBD1, anticorps Srbd1
- Sujet
- SRBD1 contains 1 S1 motif domain. The exact function of SRBD1 remains unknown.
- Poids moléculaire
- 112 kDa (MW of target protein)
-