RBM47 anticorps (Middle Region)

N° du produit ABIN633531

Détail du produit anti-RBM47 anticorps

Antigène: RBM47 (RNA Binding Motif Protein 47 (RBM47))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM47 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBM47 antibody was raised against the middle region of RBM47

Purification: Affinity purified

Immunogène: RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM47 Blocking Peptide, catalog no. 33R-3730, is also available for use as a blocking control in assays to test for specificity of this RBM47 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM47

Antigène: RBM47 (RNA Binding Motif Protein 47 (RBM47))

Autre désignation: RBM47 (RBM47 Produits)

Synonymes: anticorps NET18, anticorps 9530077J19Rik, anticorps RGD1359713, anticorps RNA binding motif protein 47, anticorps RBM47, anticorps Rbm47

Sujet: RBM47 may be involved in RNA binding and nucleotide binding.

Poids moléculaire: 57 kDa (MW of target protein)