PAPOLB anticorps (N-Term)

N° du produit ABIN633532

Détail du produit anti-PAPOLB anticorps

Antigène: PAPOLB (Poly(A) Polymerase beta (Testis Specific) (PAPOLB))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAPOLB est non-conjugé

Application: Western Blotting (WB)

Specificité: PAPOLB antibody was raised against the N terminal of PAPOLB

Purification: Affinity purified

Immunogène: PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAPOLB Blocking Peptide, catalog no. 33R-9005, is also available for use as a blocking control in assays to test for specificity of this PAPOLB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPOLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAPOLB

Antigène: PAPOLB (Poly(A) Polymerase beta (Testis Specific) (PAPOLB))

Autre désignation: PAPOLB (PAPOLB Produits)

Synonymes: anticorps PAP, anticorps Paplob, anticorps Papola-ps, anticorps Papt, anticorps Plap-ps, anticorps Tpap, anticorps papolb, anticorps si:ch211-199l3.6, anticorps wu:fc43b06, anticorps wu:fp01g10, anticorps zgc:109706, anticorps PAPT, anticorps TPAP, anticorps poly (A) polymerase beta (testis specific), anticorps poly(A) polymerase beta, anticorps poly(A) polymerase alpha, anticorps Papolb, anticorps papola, anticorps PAPOLB

Sujet: PAPOLB may be involved in transferase activity, polynucleotide adenylyltransferase activity, protein binding, RNA binding, nucleotide binding, ATP binding and nucleotidyltransferase activity.

Poids moléculaire: 72 kDa (MW of target protein)