NOC4L anticorps

N° du produit ABIN633538

Détail du produit anti-NOC4L anticorps

Antigène: NOC4L (Nucleolar Complex Associated 4 Homolog (NOC4L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOC4L est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: NOC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOC4L Blocking Peptide, catalog no. 33R-1802, is also available for use as a blocking control in assays to test for specificity of this NOC4L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOC4L

Antigène: NOC4L (Nucleolar Complex Associated 4 Homolog (NOC4L))

Autre désignation: NOC4L (NOC4L Produits)

Synonymes: anticorps NET49, anticorps NOC4, anticorps UTP19, anticorps NOC4L, anticorps AI326906, anticorps RGD1310661, anticorps net49, anticorps noc4, anticorps noc4lb, anticorps noc4la, anticorps NOC4 protein homolog, anticorps sb:cb534, anticorps wu:fb78g04, anticorps zgc:110429, anticorps nucleolar complex associated 4 homolog, anticorps NOC4 like, anticorps nucleolar complex associated 4 homolog S homeolog, anticorps nucleolar complex associated 4 homolog L homeolog, anticorps NOC4L, anticorps Noc4l, anticorps noc4l.S, anticorps noc4l.L, anticorps noc4l

Sujet: NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome.

Poids moléculaire: 57 kDa (MW of target protein)