RBM42 anticorps (C-Term)

N° du produit ABIN633539

Détail du produit anti-RBM42 anticorps

Antigène: RBM42 (RNA Binding Motif Protein 42 (RBM42))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM42 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBM42 antibody was raised against the C terminal of RBM42

Purification: Affinity purified

Immunogène: RBM42 antibody was raised using the C terminal of RBM42 corresponding to a region with amino acids DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM42 Blocking Peptide, catalog no. 33R-2115, is also available for use as a blocking control in assays to test for specificity of this RBM42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM42

Antigène: RBM42 (RNA Binding Motif Protein 42 (RBM42))

Autre désignation: RBM42 (RBM42 Produits)

Synonymes: anticorps rbm42b, anticorps MGC10433l, anticorps zgc:109907, anticorps rbm42, anticorps rbm42a, anticorps 1700003D06Rik, anticorps 3100004P22Rik, anticorps RGD1306184, anticorps RNA binding motif protein 42 L homeolog, anticorps RNA binding motif protein 42, anticorps RNA binding motif protein 42 S homeolog, anticorps rbm42.L, anticorps RBM42, anticorps rbm42, anticorps rbm42.S, anticorps Rbm42

Sujet: RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.

Poids moléculaire: 50 kDa (MW of target protein)