ESRP2 anticorps (N-Term)

N° du produit ABIN633540

Détail du produit anti-ESRP2 anticorps

Antigène: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ESRP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBM35 B antibody was raised against the N terminal of RBM35

Purification: Affinity purified

Immunogène: RBM35 B antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM35B Blocking Peptide, catalog no. 33R-1548, is also available for use as a blocking control in assays to test for specificity of this RBM35B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ESRP2

Antigène: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Autre désignation: RBM35B (ESRP2 Produits)

Synonymes: anticorps RBM35B, anticorps 9530027K23Rik, anticorps Rbm35b, anticorps RGD1310855, anticorps cb404, anticorps fa07a06, anticorps rbm35b, anticorps sb:cb404, anticorps zgc:77254, anticorps epithelial splicing regulatory protein 2, anticorps microRNA 6773, anticorps ESRP2, anticorps Esrp2, anticorps MIR6773, anticorps esrp2

Sujet: RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.

Poids moléculaire: 77 kDa (MW of target protein)