HEXIM2 anticorps (N-Term)
-
- Antigène Voir toutes HEXIM2 Anticorps
- HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HEXIM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HEXIM2 antibody was raised against the N terminal of HEXIM2
- Purification
- Affinity purified
- Immunogène
- HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES
- Top Product
- Discover our top product HEXIM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HEXIM2 Blocking Peptide, catalog no. 33R-5783, is also available for use as a blocking control in assays to test for specificity of this HEXIM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEXIM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))
- Autre désignation
- HEXIM2 (HEXIM2 Produits)
- Sujet
- HEXIM2 belongs to the HEXIM family. It is transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor.In cooperation with 7SK snRNA, HEXIM2 sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.
- Poids moléculaire
- 31 kDa (MW of target protein)
-