HEXIM2 anticorps (N-Term)

N° du produit ABIN633546

Détail du produit anti-HEXIM2 anticorps

Antigène: HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HEXIM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: HEXIM2 antibody was raised against the N terminal of HEXIM2

Purification: Affinity purified

Immunogène: HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HEXIM2 Blocking Peptide, catalog no. 33R-5783, is also available for use as a blocking control in assays to test for specificity of this HEXIM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEXIM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HEXIM2

Antigène: HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))

Autre désignation: HEXIM2 (HEXIM2 Produits)

Synonymes: anticorps 4933402L21Rik, anticorps hexamethylene bisacetamide inducible 2, anticorps hexamethylene bis-acetamide inducible 2, anticorps HEXIM2, anticorps Hexim2

Sujet: HEXIM2 belongs to the HEXIM family. It is transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor.In cooperation with 7SK snRNA, HEXIM2 sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Poids moléculaire: 31 kDa (MW of target protein)