RG9MTD3 anticorps

N° du produit ABIN633548

Détail du produit anti-RG9MTD3 anticorps

Antigène: RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RG9MTD3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RG9 MTD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RG9MTD3 Blocking Peptide, catalog no. 33R-3692, is also available for use as a blocking control in assays to test for specificity of this RG9MTD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RG9MTD3

Antigène: RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))

Autre désignation: RG9MTD3 (RG9MTD3 Produits)

Synonymes: anticorps RG9MTD3, anticorps RP11-3J10.9, anticorps bA3J10.9, anticorps Rg9mtd3, anticorps 2610042J10Rik, anticorps Rnmtd3, anticorps tRNA methyltransferase 10B, anticorps TRMT10B, anticorps Trmt10b

Sujet: RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.

Poids moléculaire: 36 kDa (MW of target protein)