RPUSD2 anticorps (C-Term)

N° du produit ABIN633550

Détail du produit anti-RPUSD2 anticorps

Antigène: RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPUSD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPUSD2 antibody was raised against the C terminal of RPUSD2

Purification: Affinity purified

Immunogène: RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPUSD2 Blocking Peptide, catalog no. 33R-1132, is also available for use as a blocking control in assays to test for specificity of this RPUSD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPUSD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPUSD2

Antigène: RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))

Autre désignation: RPUSD2 (RPUSD2 Produits)

Synonymes: anticorps RPUSD2, anticorps C15orf19, anticorps C18B11, anticorps 4921503C21Rik, anticorps 9630001E10, anticorps BB231107, anticorps RGD1306147, anticorps RNA pseudouridylate synthase domain containing 2, anticorps RPUSD2, anticorps Rpusd2

Sujet: RPUSD2 is involved in RNA binding and nucleotide binding.

Poids moléculaire: 61 kDa (MW of target protein)