MBNL1 anticorps

N° du produit ABIN633562

Détail du produit anti-MBNL1 anticorps

Antigène: MBNL1 (Muscleblind-like Protein 1 (MBNL1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBNL1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI

Information d'application

Indications d'application: WB: 0.75 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MBNL1 Blocking Peptide, catalog no. 33R-1389, is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBNL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBNL1

Antigène: MBNL1 (Muscleblind-like Protein 1 (MBNL1))

Autre désignation: MBNL1 (MBNL1 Produits)

Synonymes: anticorps MBNL1, anticorps zgc:153954, anticorps Mbnl, anticorps mKIAA0428, anticorps EXP, anticorps EXP35, anticorps EXP40, anticorps EXP42, anticorps MBNL, anticorps muscleblind like splicing regulator 1, anticorps muscleblind-like splicing regulator 1, anticorps muscleblind like splicing factor 1, anticorps MBNL1, anticorps mbnl1, anticorps Mbnl1

Sujet: MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization