SNRPA1 anticorps (Middle Region)
-
- Antigène Voir toutes SNRPA1 (SNRPA) Anticorps
- SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SNRPA1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SNRPA antibody was raised against the middle region of SNRPA
- Purification
- Affinity purified
- Immunogène
- SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
- Top Product
- Discover our top product SNRPA Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SNRPA Blocking Peptide, catalog no. 33R-6281, is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))
- Autre désignation
- SNRPA (SNRPA Produits)
- Synonymes
- anticorps Mud1, anticorps U1-A, anticorps U1A, anticorps im:7142962, anticorps zgc:101832, anticorps C430021M15Rik, anticorps Rnu1a-1, anticorps Rnu1a1, anticorps mud1, anticorps snf, anticorps fc19d01, anticorps wu:fc19d01, anticorps zgc:77810, anticorps T30B22.12, anticorps U1SNRNP-SPECIFIC PROTEIN, anticorps spliceosomal protein U1A, anticorps small nuclear ribonucleoprotein polypeptide A, anticorps small nuclear ribonucleoprotein polypeptide A', anticorps small nuclear ribonucleoprotein polypeptide A S homeolog, anticorps spliceosomal protein U1A, anticorps SNRPA, anticorps snrpa1, anticorps Snrpa, anticorps snrpa.S, anticorps snrpa, anticorps U1A
- Sujet
- SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.
- Poids moléculaire
- 31 kDa (MW of target protein)
-