HNRNPM anticorps (N-Term)
-
- Antigène Voir toutes HNRNPM Anticorps
- HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNRNPM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HNRPM antibody was raised against the N terminal Of Hnrpm
- Purification
- Affinity purified
- Immunogène
- HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
- Top Product
- Discover our top product HNRNPM Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HNRPM Blocking Peptide, catalog no. 33R-1554, is also available for use as a blocking control in assays to test for specificity of this HNRPM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM))
- Autre désignation
- HNRPM (HNRNPM Produits)
- Synonymes
- anticorps HNRPM, anticorps si:ch211-197g15.1, anticorps wu:fa10g07, anticorps wu:fa98b02, anticorps hnrpm, anticorps CG9373, anticorps Dmel\\CG9373, anticorps Hrp59, anticorps cg9373, anticorps hnRNP M, anticorps hrp59, anticorps p75, anticorps CEAR, anticorps HNRNPM4, anticorps HNRPM4, anticorps HTGR1, anticorps NAGR1, anticorps 2610023M21Rik, anticorps AA409009, anticorps Hnrpm, anticorps mKIAA4193, anticorps Hnrpm4, anticorps heterogeneous nuclear ribonucleoprotein M, anticorps Heterogeneous nuclear ribonucleoprotein M, anticorps rumpelstiltskin, anticorps HNRNPM, anticorps hnrnpm, anticorps hnrpm, anticorps rump, anticorps Hnrnpm
- Sujet
- HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
- Poids moléculaire
- 73 kDa (MW of target protein)
-