BCAS2 anticorps (N-Term)
-
- Antigène Voir toutes BCAS2 Anticorps
- BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BCAS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BCAS2 antibody was raised against the N terminal of BCAS2
- Purification
- Affinity purified
- Immunogène
- BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL
- Top Product
- Discover our top product BCAS2 Anticorps primaire
-
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (AA 116-225) antibody
BCAS2 Reactivité: Humain WB, ELISA, RNAi Hôte: Souris Monoclonal 1D10 unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (AA 1-225) antibodyBCAS2 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (AA 1-225) antibodyBCAS2 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (C-Term) antibodyBCAS2 Reactivité: Humain, Souris, Rat, Singe WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (AA 151-225) antibodyBCAS2 Reactivité: Souris WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (AA 116-225) antibodyBCAS2 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (Internal Region) antibodyBCAS2 Reactivité: Humain, Souris, Rat WB, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (N-Term) antibodyBCAS2 Reactivité: Humain, Souris, Rat, Singe, Boeuf (Vache), Chien, Lapin, Cobaye, Cheval, Poisson zèbre (Danio rerio), Poulet, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (C-Term) antibodyBCAS2 Reactivité: Humain, Souris, Rat, Singe, Boeuf (Vache), Chien, Lapin, Poulet, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Breast Carcinoma Amplified Sequence 2 (BCAS2) (Middle Region) antibodyBCAS2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Lapin, Cobaye, Cheval WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BCAS2 Blocking Peptide, catalog no. 33R-5671, is also available for use as a blocking control in assays to test for specificity of this BCAS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))
- Autre désignation
- BCAS2 (BCAS2 Produits)
- Synonymes
- anticorps DAM1, anticorps SPF27, anticorps Snt309, anticorps 6430539P16Rik, anticorps AI132645, anticorps C76366, anticorps C80030, anticorps BCAS2, anticorps cb302, anticorps zgc:101730, anticorps BCAS2, pre-mRNA processing factor, anticorps breast carcinoma amplified sequence 2, anticorps breast carcinoma amplified sequence 2 L homeolog, anticorps BCAS2, anticorps Bcas2, anticorps bcas2, anticorps bcas2.L, anticorps CpipJ_CPIJ003889
- Sujet
- BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.
- Poids moléculaire
- 26 kDa (MW of target protein)
-
