CARS anticorps (C-Term)

N° du produit ABIN633577

Détail du produit anti-CARS anticorps

Antigène: CARS (Cysteinyl-tRNA Synthetase (CARS))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CARS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CARS antibody was raised against the C terminal of CARS

Purification: Affinity purified

Immunogène: CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CARS Blocking Peptide, catalog no. 33R-4626, is also available for use as a blocking control in assays to test for specificity of this CARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CARS

Antigène: CARS (Cysteinyl-tRNA Synthetase (CARS))

Autre désignation: CARS (CARS Produits)

Synonymes: anticorps sb:cb71, anticorps CARS, anticorps BcDNA:LD21177, anticorps CG8431, anticorps CRS, anticorps CysRS, anticorps Dmel\\CG8431, anticorps BA0089, anticorps DDBDRAFT_0215191, anticorps DDBDRAFT_0231320, anticorps DDB_0215191, anticorps DDB_0231320, anticorps DDBDRAFT_0187313, anticorps DDBDRAFT_0231318, anticorps DDB_0187313, anticorps DDB_0231318, anticorps T16B12.16, anticorps K15E6.3, anticorps K15E6_3, anticorps CARS1, anticorps CYSRS, anticorps MGC:11246, anticorps CA3, anticorps cysteinyl-tRNA synthetase, anticorps Cysteinyl-tRNA synthetase, anticorps cysteine--tRNA ligase, anticorps cysteine-tRNA ligase, anticorps Cysteinyl-tRNA synthetase, class Ia family protein, anticorps cysteinyl-tRNA synthetase CysS, anticorps cysteinyl-tRNA synthetase S homeolog, anticorps CARS, anticorps cars, anticorps CysRS, anticorps cysS, anticorps APH_RS02395, anticorps mcysS, anticorps SYCO ARATH, anticorps AT3G56300, anticorps AT5G38830, anticorps cars.S, anticorps Cars

Sujet: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.

Poids moléculaire: 81 kDa (MW of target protein)