RPL18 anticorps (N-Term)

N° du produit ABIN633580

Détail du produit anti-RPL18 anticorps

Antigène: RPL18 (Ribosomal Protein L18 (RPL18))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL18 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPL18 antibody was raised against the N terminal of RPL18

Purification: Affinity purified

Immunogène: RPL18 antibody was raised using the N terminal of RPL18 corresponding to a region with amino acids MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL18 Blocking Peptide, catalog no. 33R-6085, is also available for use as a blocking control in assays to test for specificity of this RPL18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL18

Antigène: RPL18 (Ribosomal Protein L18 (RPL18))

Autre désignation: RPL18 (RPL18 Produits)

Synonymes: anticorps L18, anticorps Rpl18a, anticorps fa98d03, anticorps wu:fa98d03, anticorps zgc:92872, anticorps rpl14a, anticorps rpl18, anticorps CG8615, anticorps Dmel\\CG8615, anticorps Rp L18, anticorps RpL18e, anticorps ribosomal protein L18, anticorps 60S ribosomal protein L18, anticorps ribosomal protein L18 S homeolog, anticorps 50S ribosomal protein L18, anticorps Ribosomal protein L18, anticorps RPL18, anticorps Rpl18, anticorps rpl-18, anticorps rpl18, anticorps rpl18.S, anticorps RpL18

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Poids moléculaire: 22 kDa (MW of target protein)