EIF4E3 anticorps (Middle Region)
-
- Antigène Voir toutes EIF4E3 Anticorps
- EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF4E3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF4 E3 antibody was raised against the middle region of EIF4 3
- Purification
- Affinity purified
- Immunogène
- EIF4 E3 antibody was raised using the middle region of EIF4 3 corresponding to a region with amino acids VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
- Top Product
- Discover our top product EIF4E3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF4E3 Blocking Peptide, catalog no. 33R-9766, is also available for use as a blocking control in assays to test for specificity of this EIF4E3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))
- Autre désignation
- EIF4E3 (EIF4E3 Produits)
- Synonymes
- anticorps eif4e3, anticorps wu:fc31f11, anticorps wu:fd15f11, anticorps zgc:92189, anticorps DDBDRAFT_0191035, anticorps DDBDRAFT_0234256, anticorps DDB_0191035, anticorps DDB_0234256, anticorps IF4E3, anticorps 1300018P11Rik, anticorps AI451927, anticorps eIF4E-3, anticorps eukaryotic translation initiation factor 4E family member 3, anticorps eukaryotic translation initiation factor 4E family member 3 L homeolog, anticorps eukaryotic translation initiation factor 4E member 3, anticorps eukaryotic translation initiation factor 4E family member 3 S homeolog, anticorps EIF4E3, anticorps Eif4e3, anticorps eif4e3.L, anticorps eif4e3, anticorps eIF4e3, anticorps eif4e3.S
- Sujet
- EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.
- Poids moléculaire
- 24 kDa (MW of target protein)
-