SFRS7 anticorps (Middle Region)
-
- Antigène Voir toutes SFRS7 Anticorps
- SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SFRS7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SFRS7 antibody was raised against the middle region of SFRS7
- Purification
- Affinity purified
- Immunogène
- SFRS7 antibody was raised using the middle region of SFRS7 corresponding to a region with amino acids SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP
- Top Product
- Discover our top product SFRS7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFRS7 Blocking Peptide, catalog no. 33R-8776, is also available for use as a blocking control in assays to test for specificity of this SFRS7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))
- Autre désignation
- SFRS7 (SFRS7 Produits)
- Synonymes
- anticorps 9G8, anticorps AAG3, anticorps SFRS7, anticorps 35kDa, anticorps 9430065L19Rik, anticorps NX-96, anticorps Sfrs7, anticorps 9g8, anticorps aag3, anticorps sfrs7, anticorps srsf7, anticorps zgc:114203, anticorps serine and arginine rich splicing factor 7, anticorps serine/arginine-rich splicing factor 7, anticorps serine/arginine-rich splicing factor 7 L homeolog, anticorps serine/arginine-rich splicing factor 7b, anticorps SRSF7, anticorps Srsf7, anticorps srsf7.L, anticorps srsf7b
- Sujet
- SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.
- Poids moléculaire
- 27 kDa (MW of target protein)
-