BAT1 anticorps (N-Term)

N° du produit ABIN633595

Détail du produit anti-BAT1 anticorps

Antigène: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BAT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: BAT1 antibody was raised against the N terminal of BAT1

Purification: Affinity purified

Immunogène: BAT1 antibody was raised using the N terminal of BAT1 corresponding to a region with amino acids MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BAT1 Blocking Peptide, catalog no. 33R-5641, is also available for use as a blocking control in assays to test for specificity of this BAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BAT1

Antigène: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Autre désignation: BAT1 (DDX39 Produits)

Synonymes: anticorps dxd39, anticorps MGC53693, anticorps MGC130793, anticorps ddx39, anticorps MGC53944, anticorps DDX39, anticorps 2610307C23Rik, anticorps BAT1, anticorps DDXL, anticorps Ddx39a, anticorps URH49, anticorps bat1, anticorps uap56, anticorps D6S81E, anticorps UAP56, anticorps Bat1, anticorps Bat1a, anticorps p47, anticorps DEAD-box helicase 39A S homeolog, anticorps nuclear RNA helicase, anticorps DExD-box helicase 39A, anticorps DEAD-box helicase 39A, anticorps ATP-dependent RNA helicase DDX39, anticorps ATP-dependent RNA helicase DDX39A, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, anticorps DEAD-box helicase 39B L homeolog, anticorps DExD-box helicase 39B, anticorps ddx39a.S, anticorps ddx39, anticorps DDX39A, anticorps ddx39a, anticorps LOC100084960, anticorps ddx39b, anticorps Ddx39, anticorps ddx39b.L, anticorps DDX39B, anticorps Ddx39b

Sujet: BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization