IRAK3 anticorps (C-Term)

N° du produit ABIN633596

Détail du produit anti-IRAK3 anticorps

Antigène: IRAK3 (Interleukin-1 Receptor-Associated Kinase 3 (IRAK3))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IRAK3 est non-conjugé

Application: Western Blotting (WB)

Specificité: IRAK3 antibody was raised against the C terminal of IRAK3

Purification: Affinity purified

Immunogène: IRAK3 antibody was raised using the C terminal of IRAK3 corresponding to a region with amino acids NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IRAK3 Blocking Peptide, catalog no. 33R-6900, is also available for use as a blocking control in assays to test for specificity of this IRAK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IRAK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IRAK3

Antigène: IRAK3 (Interleukin-1 Receptor-Associated Kinase 3 (IRAK3))

Autre désignation: IRAK3 (IRAK3 Produits)

Synonymes: anticorps IRAK3, anticorps si:dkey-150i15.2, anticorps ASRT5, anticorps IRAKM, anticorps IrakM, anticorps 4833428C18Rik, anticorps AI563835, anticorps IRAK-M, anticorps interleukin 1 receptor associated kinase 3, anticorps interleukin-1 receptor-associated kinase 3, anticorps IRAK3, anticorps irak3, anticorps Irak3

Sujet: IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades