AKAP1 anticorps

N° du produit ABIN633600

Détail du produit anti-AKAP1 anticorps

Antigène: AKAP1 (A Kinase (PRKA) Anchor Protein 1 (AKAP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKAP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKAP1 Blocking Peptide, catalog no. 33R-9725, is also available for use as a blocking control in assays to test for specificity of this AKAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKAP1

Antigène: AKAP1 (A Kinase (PRKA) Anchor Protein 1 (AKAP1))

Autre désignation: AKAP1 (AKAP1 Produits)

Synonymes: anticorps AKAP1, anticorps akap1, anticorps fa08b04, anticorps wu:fa08b04, anticorps AKAP, anticorps AKAP121, anticorps AKAP149, anticorps AKAP84, anticorps D-AKAP1, anticorps PPP1R43, anticorps PRKA1, anticorps SAKAP84, anticorps TDRD17, anticorps Akap, anticorps C76494, anticorps C81186, anticorps DAKAP1, anticorps S-AKAP84, anticorps Akap84, anticorps A-kinase anchoring protein 1, anticorps A kinase (PRKA) anchor protein 1b, anticorps A kinase (PRKA) anchor protein 1, anticorps AKAP1, anticorps akap1b, anticorps akap1, anticorps Akap1

Sujet: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Synaptic Membrane