YARS anticorps (N-Term)

N° du produit ABIN633610

Détail du produit anti-YARS anticorps

Antigène: YARS (Yars) (Tyrosyl-tRNA Synthetase (Yars))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp YARS est non-conjugé

Application: Western Blotting (WB)

Specificité: YARS antibody was raised against the N terminal of YARS

Purification: Affinity purified

Immunogène: YARS antibody was raised using the N terminal of YARS corresponding to a region with amino acids MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

YARS Blocking Peptide, catalog no. 33R-6016, is also available for use as a blocking control in assays to test for specificity of this YARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur YARS

Antigène: YARS (Yars) (Tyrosyl-tRNA Synthetase (Yars))

Autre désignation: YARS (Yars Produits)

Synonymes: anticorps CMTDIC, anticorps TYRRS, anticorps YRS, anticorps YTS, anticorps AL024047, anticorps AU018965, anticorps cb204, anticorps wu:fk52b08, anticorps YARS, anticorps cmtdic, anticorps tyrrs, anticorps yrs, anticorps yts, anticorps CG4561, anticorps Dmel\\CG4561, anticorps TyrRS, anticorps anon-EST:Posey261, anticorps dYARS, anticorps GB10789, anticorps tyrosyl-tRNA synthetase, anticorps tyrosyl-tRNA synthetase L homeolog, anticorps tyrosyl-tRNA synthetase, putative, anticorps tyrosine--tRNA ligase, anticorps Tyrosyl-tRNA synthetase, anticorps tyrosine--tRNA ligase, cytoplasmic, anticorps YARS, anticorps Yars, anticorps yars, anticorps yars.L, anticorps MAL8P1.125, anticorps MEFER_RS04475, anticorps TyrRS, anticorps LOC413909, anticorps LOC100163888, anticorps LOC100282315

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.

Poids moléculaire: 59 kDa (MW of target protein)