FXR1 anticorps (C-Term)

N° du produit ABIN633611

Détail du produit anti-FXR1 anticorps

Antigène: FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FXR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FXR1 antibody was raised against the C terminal of FXR1

Purification: Affinity purified

Immunogène: FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FXR1 Blocking Peptide, catalog no. 33R-2671, is also available for use as a blocking control in assays to test for specificity of this FXR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FXR1

Antigène: FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))

Autre désignation: FXR1 (FXR1 Produits)

Synonymes: anticorps FXR1P, anticorps wu:fb16f11, anticorps wu:fd18c10, anticorps zgc:66226, anticorps Fxr1h, anticorps Fxr1p, anticorps XtFxr1p, anticorps fxr1h, anticorps xFxr1p, anticorps FXR1, anticorps 1110050J02Rik, anticorps 9530073J07Rik, anticorps AI851072, anticorps xfxr1, anticorps fxr1, anticorps FMR1 autosomal homolog 1, anticorps fragile X mental retardation, autosomal homolog 1, anticorps fragile X mental retardation gene 1, autosomal homolog, anticorps FMR1 autosomal homolog 1 L homeolog, anticorps FMR1 autosomal homolog 1 S homeolog, anticorps FXR1, anticorps fxr1, anticorps Fxr1, anticorps fxr1.L, anticorps fxr1.S

Sujet: FXR1 is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit.

Poids moléculaire: 68 kDa (MW of target protein)