KCTD15 anticorps (N-Term)
-
- Antigène Voir toutes KCTD15 Anticorps
- KCTD15 (Potassium Channel Tetramerisation Domain Containing 15 (KCTD15))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCTD15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCTD15 antibody was raised against the N terminal of KCTD15
- Purification
- Affinity purified
- Immunogène
- KCTD15 antibody was raised using the N terminal of KCTD15 corresponding to a region with amino acids PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL
- Top Product
- Discover our top product KCTD15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCTD15 Blocking Peptide, catalog no. 33R-7424, is also available for use as a blocking control in assays to test for specificity of this KCTD15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCTD15 (Potassium Channel Tetramerisation Domain Containing 15 (KCTD15))
- Autre désignation
- KCTD15 (KCTD15 Produits)
- Synonymes
- anticorps BC031749, anticorps kctd15, anticorps zgc:100865, anticorps fa02e12, anticorps kctd15l, anticorps wu:fa02e12, anticorps zgc:103747, anticorps potassium channel tetramerization domain containing 15, anticorps potassium channel tetramerisation domain containing 15, anticorps potassium channel tetramerization domain containing 15 L homeolog, anticorps potassium channel tetramerization domain containing 15b, anticorps potassium channel tetramerization domain containing 15a, anticorps KCTD15, anticorps Kctd15, anticorps kctd15.L, anticorps kctd15b, anticorps kctd15a
- Sujet
- KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.
- Poids moléculaire
- 26 kDa (MW of target protein)
-