VDAC3 anticorps (N-Term)
-
- Antigène Voir toutes VDAC3 Anticorps
- VDAC3 (Voltage-Dependent Anion Channel 3 (VDAC3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VDAC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- VDAC3 antibody was raised against the N terminal of VDAC3
- Purification
- Affinity purified
- Immunogène
- VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE
- Top Product
- Discover our top product VDAC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VDAC3 Blocking Peptide, catalog no. 33R-8339, is also available for use as a blocking control in assays to test for specificity of this VDAC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VDAC3 (Voltage-Dependent Anion Channel 3 (VDAC3))
- Autre désignation
- VDAC3 (VDAC3 Produits)
- Synonymes
- anticorps HD-VDAC3, anticorps VDAC-3, anticorps VDAC1P5, anticorps VDAC5P, anticorps VDAC3, anticorps wu:fb01e12, anticorps zgc:77898, anticorps hd-vdac3, anticorps ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 3, anticorps ATVDAC3, anticorps AtVDAC3, anticorps Athsr2, anticorps F2G14.210, anticorps F2G14_210, anticorps voltage dependent anion channel 3, anticorps voltage dependent anion channel 3, anticorps voltage-dependent anion channel 3, anticorps voltage-dependent anion channel 3 L homeolog, anticorps VDAC3, anticorps Vdac3, anticorps vdac3, anticorps vdac3.L
- Sujet
- VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase and glycerol kinase.
- Poids moléculaire
- 31 kDa (MW of target protein)
-